ICP-MS comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-05-09. Numbers and descriptions here follow the published literature rather than marketing material.
Characterizing GHK-Cu requires methods that distinguish the intact complex from free peptide and unbound copper. UV-visible absorption around 600 nm provides a rapid check for copper coordination, while circular dichroism reports on peptide secondary structure. Mass spectrometry confirms the peptide mass and can detect copper adducts under carefully controlled conditions. Electron paramagnetic resonance is particularly informative for Cu(II) because it reveals the ligand field symmetry. No single technique fully defines the complex, so laboratories combine orthogonal methods.
Stability of GHK-Cu in solution depends on pH, temperature, buffer composition, and oxygen exposure. The copper center can undergo reduction or dissociation, especially in the presence of strong metal chelators such as EDTA. Aqueous solutions are often prepared fresh or stored frozen to limit degradation. Lyophilized solid is more stable than liquid formulations, but it can absorb moisture and should be kept dry. Light exposure may also affect copper complexes, though the effect is often modest.
Purity assessment typically involves high-performance liquid chromatography for the peptide and atomic spectroscopy for copper content. The ratio of copper to peptide is a key quality parameter; a value near one indicates proper stoichiometry. Impurities can include free peptide, copper salts, and truncated sequences from synthesis. Because the complex is dynamic, sample preparation and mobile-phase conditions can shift the observed species. Reported purity values therefore depend on the analytical method and should be interpreted with that context.
Aqueous solutions of GHK-Cu are less stable than the dry powder. The peptide backbone is vulnerable to hydrolysis at extreme pH, and copper can be stripped from the complex by strong chelating agents such as EDTA or citrate. Oxidising agents and high concentrations of ascorbic acid can reduce copper(II) and change the complex, which is one reason formulators often keep such ingredients in separate phases. How quickly these changes occur under real storage conditions depends on pH, buffer, temperature and packaging, and quantitative data on the subject are limited.
Dry material is normally held cold, commonly at -20 °C for long-term storage and 2 to 8 °C for working quantities, protected from light and moisture. Vials should be allowed to reach room temperature before opening so that condensation does not form on the powder. In liquid formulations the complex is generally kept near neutral to slightly acidic pH, because strongly alkaline conditions favour precipitation of copper hydroxide. Antioxidants or chelate-stabilising excipients are often added, though the specific approaches are proprietary and rarely published in detail.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For lyophilized solid; solutions are less stable |
| Common analytical method | RP-HPLC with UV detection | For peptide purity; copper quantified separately |
| Copper quantification | ICP-MS or atomic absorption | Determines metal content and stoichiometry |
| Aqueous stability | Hours to days at room temperature | Depends on pH, buffer, and chelators |
| Color in solution | Blue | Absorption near 600 nm indicates Cu(II) coordination |
Laboratory characterization of GHK-Cu typically combines separation, spectroscopic, and elemental techniques. Reverse-phase high-performance liquid chromatography is widely used to assess peptide purity, often with ultraviolet detection near the copper-related absorption band or with mass spectrometry for identity confirmation. Because the molecule contains copper, elemental methods such as inductively coupled plasma mass spectrometry or atomic absorption spectroscopy are used to quantify metal content and confirm stoichiometry. No single universal pharmacopeial monograph exists for GHK-Cu. Laboratories therefore validate their own methods, and reported purity values depend on the chosen assay and calibration standards.
Stability of GHK-Cu is influenced by light, oxygen, moisture, pH, and temperature. Solid material is generally kept desiccated and frozen to reduce hydrolysis and oxidation, while aqueous solutions are best prepared fresh or stored cold in aliquots. Repeated freeze-thaw cycles can promote aggregation, precipitation, or peptide degradation. Copper coordination may change under strongly acidic or alkaline conditions, potentially altering the complex's spectroscopic properties. Published long-term stability data for specific matrices, such as cosmetic emulsions or biological buffers, are limited, so shelf-life claims should be treated as formulation-specific rather than universal.
Identity and purity are established with a combination of chromatographic and spectroscopic techniques. Reversed-phase high-performance liquid chromatography separates the intact complex from peptide fragments and free copper, and the elution profile yields a purity estimate. Mass spectrometry gives the mass of the intact species and exposes degradation products. Ultraviolet-visible spectroscopy displays a broad absorption band in the visible region that is characteristic of the copper center. Nuclear magnetic resonance is less informative here, because the paramagnetic metal broadens signals and complicates spectral interpretation.
Copper content is measured separately, since a peptide assay alone does not report the metal-to-peptide ratio. Elemental techniques such as inductively coupled plasma optical emission spectroscopy quantify copper after acid digestion of the sample. The result is compared with the theoretical value for a one-to-one complex, and a shortfall indicates free peptide or partial dissociation. Suppliers differ in how they state purity, as some quote peptide content and others quote the whole complex. A defined stoichiometry therefore requires both a peptide assay and a copper assay.
The molecular weight and charge of GHK-Cu depend on the pH and the number of coordinated ligands. At neutral pH, the peptide typically binds one copper ion, but ternary complexes with other biomolecules can form. Spectroscopic methods such as electron paramagnetic resonance and circular dichroism are used to study the coordination environment. Reports on the exact geometry vary because the complex is dynamic in solution. Researchers often use synthetic GHK-Cu rather than extracted material to control stoichiometry and purity.
GHK-Cu is a coordination complex formed from the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, the terminal amino group, and the deprotonated amide nitrogen. This arrangement creates a square-planar or distorted geometry around the metal center, depending on pH and the presence of competing ligands. The complex occurs naturally in human plasma, saliva, and urine at low concentrations, and its sequence is conserved across many vertebrate species.
Discovery of GHK is generally attributed to work in the 1970s that isolated a plasma factor influencing liver cell behavior. Subsequent studies identified the copper-binding tripeptide and its ability to chelate copper with high affinity. Early reports linked the complex to wound healing and tissue remodeling in animal models. The free peptide and the copper-bound form have different properties, so the two are distinguished in the literature. Whether endogenous GHK-Cu serves a single primary physiological role remains an open question.
== Synthesis == Phosphorimidazolide reagents have been synthesized from phosphate mono-esters. In one method, a phosphate mono-ester is dissolved in anhydrous pyridine or N,N-dimethylformamide (DMF) and activated using triphenylphosphine (PPh3) and 2,2’-Dithiodipyridine (2,2’-DTDP) in the presence of triethylamine (TEA) base and excess imidazole. In another method using fewer reagents, a phosphate mono-ester is dissolved in DMF and carbonyldiimidazole (CDI) is used to both remove an oxygen atom from the phosphate group and supply the imidazole substituent. The product of either reaction may be collected by precipitation using acetonitrile or acetone as antisolvent with sodium or lithium perchlorate to supply the sodium or lithium salt of the phosphorimidazolide respectively. Alternatively, the phosphorimidazolide may be isolated by reverse-phase flash column chromatography with TEAB buffer and acetonitrile.
=== Complications === Pulp acts as a security and alarm system. Slight decay in tooth structure not extending to the dentin may not alarm the pulp, but as the dentin gets exposed, due either to dental caries or trauma, sensitivity starts. The dentinal tubules pass the stimulus to the pulp's odontoblastic layer, triggering the response. This mainly responds to cold. At this stage, simple restoration can be performed. As the decay progresses near the pulp, the response magnifies. Sensation to heat and cold increases. At this stage, indirect pulp capping may be advisable. At this stage it may be impossible to clinically diagnose the extent of decay. Carious dentin by dental decay progressing to the pulp may get fractured during mastication, traumatizing the pulp, resulting in pulpitis. Pulpitis can be painful and may call for root canal therapy or endodontic therapy. Traumatized pulp starts an inflammatory response. The hard and closed surroundings builds pressure inside the pulp chamber, compressing the nerve fibres and eliciting pain. At this stage, the pulp starts to die, progressing to periapical abscess formation (chronic pulpitis). Pulp horns recede with age. The pulp undergoes a decrease in intercellular substance, water, and cells as it fills with collagen fibers. This decrease in cells is evident in the reduced number of undifferentiated mesenchymal cells. The pulp becomes more fibrotic, reducing the regenerative capacity of the pulp due to the loss of these cells.
== History == Cyclofenil was first introduced for medical use in 1970 under the brand name Ondogyne in France. Subsequently, it was introduced throughout the world under a variety of other brand names, including its most well-known brand name Sexovid.
Sources: en.wikipedia.org
Evidence indicating that proximity in principal component analysis in the studies of morphological variation is not necessarily indicative of close phylogenetic affinities of fossil hominins is presented by Raskin et al. (2026). Evidence indicating that hominins repeatedly inhabited areas of Africa with climate suitable for both cutaneous and visceral leishmaniasis during their evolutionary history is presented by Trájer (2026). Evidence from the study of ethnohistorical and ethnographic records of modern endurance pursuit hunters, indicating that optimization of subsistence efficiency and signaling of hunting prowess were likely the primary selective pressures in the evolution of a running gait of early hominins, is presented by Winterhalder & Morin (2026). Joordens & Schagatay (2026) argue that exceptional stamina and aerobic endurance of humans compared to other apes might be a result of underwater foraging and changes in cardiorespiratory physiology related to development of endurance breath-hold diving by coastal hominin populations. Hunter et al. (2026) compare the carpal morphology of apes (including fossil hominins and modern humans), providing evidence of hominins and extant African apes sharing morphological features of carpal morphology that are likely linked to knuckle walking, and argue that human wrist evolved from an African ape-like wrist.
The unsanitary conditions engendered by the war, severe overcrowding in barracks, wartime propaganda interfering with public health warnings, and migration of so many soldiers around the world helped the outbreak become a pandemic. Ultimately, World War I created a decisive break with the old world order that had emerged after the Napoleonic Wars, which was modified by the mid-19th century's nationalistic revolutions. The results of World War I would be important factors in the development of World War II approximately 20 years later.
Affimer molecules, also known as adhiron, are small proteins that bind to target proteins with affinity in the nanomolar range. These engineered non-antibody binding proteins are designed to mimic the molecular recognition characteristics of monoclonal antibodies in different applications. These affinity reagents have been optimized to increase their stability, make them tolerant to a range of temperatures and pH, reduce their size, and to increase their expression in E.coli and mammalian cells.
Sources: en.wikipedia.org
== Objectives == To promote the advancement of education and research into epidemiology, pathology, diagnosis, prevention and management of wounds of all aetiologies. To arrange conferences on aspects of wound management throughout Europe. To arrange multi-centre, multi-disciplinary training courses on topical aspects of wound healing. To create a forum for networking for all individuals and organisations interested in wound management
== External links == visfatin,+human at the U.S. National Library of Medicine Medical Subject Headings (MeSH) NAMPT human gene location in the UCSC Genome Browser. NAMPT human gene details in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: P43490 (Human Nicotinamide phosphoribosyltransferase) at the PDBe-KB. Overview of all the structural information available in the PDB for UniProt: Q99KQ4 (Mouse Nicotinamide phosphoribosyltransferase) at the PDBe-KB.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
=== The Hagedorn Prize === The Hagedorn Prize, named after Hans Christian Hagedorn, celebrates achievements in the understanding and treatment of diabetes. Hagedorn's work significantly advanced the quality of insulin production and diabetes care, making this award a tribute to his legacy in the field. The Hagedorn Prize is recognised as the most prestigious award in Internal Medicine in Denmark.. Hagedorn died in 1971 at age 83.
Sources: en.wikipedia.org
Peptide content is usually measured by reverse-phase high-performance liquid chromatography, while copper is measured by atomic spectroscopy. Mass spectrometry can confirm the peptide identity and detect copper adducts. Combining these methods gives a more complete picture.
pH, temperature, oxygen, light, and the presence of metal chelators all influence stability. Strong chelators can strip copper from the peptide, and reducing agents can change the copper oxidation state. Lyophilized solid stored cold and dry is generally more stable than aqueous solutions.
Purity is method-dependent because different techniques detect different impurities. A peptide purity value from HPLC does not describe copper content or the amount of free peptide. Reports should specify the analytical method and the ratio of copper to peptide.
Dry powder is best kept cold, dark and sealed, typically at -20 °C for long-term storage or 2 to 8 °C for material in regular use. Vials should be warmed to room temperature before opening to prevent moisture condensing on the contents. Aqueous stock solutions degrade faster and are usually prepared fresh.