The short version of copper assay fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-03-27 and is reviewed periodically as new material appears.
Dry material is typically held at low temperature, often around minus twenty degrees Celsius, and protected from moisture and light. Copper complexes can release their metal ion under acidic conditions or in the presence of competing chelators. Hydrolysis of the peptide backbone is a slower but real pathway, and the histidine residue is susceptible to oxidation over long periods. Stability statements therefore depend on formulation, pH, and container, and they should be read as conditional rather than absolute.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry. Copper content is measured separately by techniques such as inductively coupled plasma mass spectrometry or atomic absorption. Amino acid analysis confirms the peptide sequence after hydrolysis. Because the metal and the peptide can be quantified independently, a complete certificate of analysis normally reports both values rather than a single purity figure. This separation of measurements is important when comparing suppliers.
GHK-Cu is a coordination complex formed from the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, the terminal amino group, and the deprotonated amide nitrogen. This arrangement creates a square-planar or distorted geometry around the metal center, depending on pH and the presence of competing ligands. The complex occurs naturally in human plasma, saliva, and urine at low concentrations, and its sequence is conserved across many vertebrate species.
Discovery of GHK is generally attributed to work in the 1970s that isolated a plasma factor influencing liver cell behavior. Subsequent studies identified the copper-binding tripeptide and its ability to chelate copper with high affinity. Early reports linked the complex to wound healing and tissue remodeling in animal models. The free peptide and the copper-bound form have different properties, so the two are distinguished in the literature. Whether endogenous GHK-Cu serves a single primary physiological role remains an open question.
The molecular weight and charge of GHK-Cu depend on the pH and the number of coordinated ligands. At neutral pH, the peptide typically binds one copper ion, but ternary complexes with other biomolecules can form. Spectroscopic methods such as electron paramagnetic resonance and circular dichroism are used to study the coordination environment. Reports on the exact geometry vary because the complex is dynamic in solution. Researchers often use synthetic GHK-Cu rather than extracted material to control stoichiometry and purity.
| Property | Value | Notes |
|---|---|---|
| Solubility | Soluble in water | Free peptide differs from the complex |
| Typical storage | approx. −20 °C, desiccated | Protect from light and moisture |
| Primary purity method | RP-HPLC with MS | Confirms peptide identity |
| Copper assay | ICP-MS or AAS | Measured separately from peptide purity |
| Main degradation routes | Metal loss, hydrolysis, oxidation | Rate depends on pH and matrix |
The tripeptide was first isolated from a human plasma filtrate in 1973 during studies of tissue repair factors. Later work detected the free peptide and its copper complex in saliva, urine, and wound fluid, suggesting a natural role in tissue remodeling. Plasma concentrations reported in early literature decline with age, a pattern often cited in discussions of skin aging. Whether these endogenous levels are directly functional or largely incidental remains an open question. The peptide sequence is conserved across mammalian species.
Material described in research and cosmetic supply chains is typically a synthetic peptide supplied as a lyophilized powder. Purity is commonly reported through chromatographic separation, often at 95 percent or higher, while copper content is confirmed by separate elemental analysis. Batch variation in color and solubility can reflect residual counter-ions, moisture, or partial oxidation of the peptide. Because the complex is not a single regulatory entity, specifications differ between suppliers and are not standardized internationally.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, its terminal amino group, and a deprotonated amide nitrogen, creating a stable chelate ring. The resulting complex carries a distinctive blue to blue-violet color, which arises from copper d-d electronic transitions. In the solid state it is usually handled as a powder, while in solution the complex can dissociate and re-form depending on pH and competing ligands. The name copper tripeptide-1 is widely used in ingredient listings.
GHK-Cu is the copper-binding complex formed by the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The free peptide is usually written as GHK, and the complex is written as GHK-Cu or Cu-GHK. The sequence was identified in human plasma and later detected in saliva and urine. Its name comes from the single-letter codes of glycine, histidine and lysine. The complex is widely described as a naturally occurring carrier of copper in blood rather than as a free peptide with its own hormonal role.
Copper binds to the peptide through the histidine imidazole nitrogen and the terminal amino group, forming a stable square-planar complex. Binding constants reported for copper(II) with GHK are high, so the peptide competes effectively for copper in solution. The complex absorbs visible light, which gives solutions a blue to violet colour. Whether the metal-free peptide has a distinct biological function of its own is still an open question; some work treats it mainly as a copper delivery vehicle, while other work reports peptide-specific effects.
The compound was first isolated from human plasma in the 1970s by Loren Pickart, who later described copper-binding activity in liver and other tissues. Early reports focused on its presence in blood and its ability to carry copper between proteins. Commercial and cosmetic use of the term 'copper peptide' has since broadened, and labels rarely distinguish GHK-Cu from other copper-binding fragments. This naming overlap makes literature searching harder, because cosmetic ingredient lists, supplier catalogues and laboratory papers use different vocabularies for the same molecule.
=== Physical Health === Viruses, bacteria, protists, fungi, and more may rapidly kill insects on farms. For example, Acheta domesticus densovirus resulted in millions of dollars in lost product and some farms losing their entire livestock population in outbreaks that have spanned 35 years of industry history in North America and the United States. Some insect diseases appear to be specific to single species or taxonomic groups within the insects, and thus may not spread between species, while others may be able to infect multiple farmed insect species if housed in the same facility. Humans can carry diseases from the outside world to farmed insects. For instance, the company Van de Ven had a pathogen outbreak that killed all of its Zophobas morio beetle larvae, and the breeders hypothesized that the disease may have been brought by human visitors. Accordingly, the International Platform for Insects as Food and Feed have developed guidance on hygiene procedures for farms with the goal of protecting consumer and animal health. More integration of the veterinary and pathology communities, which are staples of traditional vertebrate animal farming, with the new insect farming sector may result in improved animal health, increased biosecurity, and better consumer protection over time. Insects may be injured due to aggression or cannibalism. Low temperatures, disease, or poor nutrition may result in deformities during any stage of development.
=== Polymerization and hydration === Monomeric CH2O is a gas and is rarely encountered in the laboratory. Aqueous formaldehyde, unlike some other small aldehydes (which need specific conditions to oligomerize through aldol condensation) oligomerizes spontaneously at a common state. The trimer 1,3,5-trioxane, (CH2O)3, is a typical oligomer. Many cyclic oligomers of other sizes have been isolated. Similarly, formaldehyde hydrates to give the geminal diol methanediol, which condenses further to form hydroxy-terminated oligomers HO(CH2O)nH. The polymer is called paraformaldehyde. The higher concentration of formaldehyde—the more equilibrium shifts towards polymerization. Diluting with water or increasing the solution temperature, as well as adding alcohols (such as methanol or ethanol) lowers that tendency. Gaseous formaldehyde polymerizes at active sites on vessel walls, but the mechanism of the reaction is unknown. Small amounts of hydrogen chloride, boron trifluoride, or stannic chloride present in gaseous formaldehyde provide the catalytic effect and make the polymerization rapid.
== History == Use of castor oil as a laxative is attested to in the c. 1550 BC Ebers Papyrus, and it was in use several centuries earlier. Midwifery manuals from the 19th century recommended castor oil and 10 drops of laudanum for relieving "false pains".
Sources: en.wikipedia.org
Systemin plays a critical role in defence signalling in tomato. It promotes the synthesis of over 20 defence-related proteins, mainly antinutritional proteins, signaling pathway proteins and proteases. The over-expression of the prosystemin resulted in a significant decrease of the larvae damage, indicating that a high level of constitutive protection is superior to an inducible defence mechanism. However, the continuous activation of prosystemin is costly, affecting the growth, the physiology and the reproductive success of tomato plants. When systemin was silenced, production of protease inhibitors in tomato was severely impaired and larvae feeding on the plants grew three times as fast. HypSys caused similar changes in gene expression in tobacco, for example polyphenol oxidase activity increased tenfold in tobacco leaves and protease inhibitors caused a 30% decrease in chymotrypsin activity within three days of wounding. When HypSys was over-expressed in tobacco, larvae feeding on transgenic plants weighed half as much after ten days feeding, as those feeding on normal plants. The concentration of hydrogen peroxide increased in the vasculature tissues when the production of systemin, HypSys or AtPep1 is induced, this may also be involved in initiating systemic acquired resistance. Tomato plants over-expressing systemin also accumulated HypSys but did not if the systemin precursor was silenced, indicating that in tomato, HypSys is controlled by systemin. Each of the three HypSys peptides in tomato is able to activate the synthesis and accumulation of protease inhibitors.
== Mathematical work == Abel's work on elliptic functions was built on Legendre's, and some of Gauss's work in statistics and number theory completed that of Legendre. He developed, and first communicated to his contemporaries before Gauss, the least squares method which has broad application in linear regression, signal processing, statistics, and curve fitting; this was published in 1806 as an appendix to his book on the paths of comets. Today, the term "least squares method" is used as a direct translation from the French "méthode des moindres carrés". His major work is Exercices de Calcul Intégral, published in three volumes in 1811, 1817 and 1819. In the first volume he introduced the basic properties of elliptic integrals, beta functions and gamma functions, introducing the symbol Γ and normalizing it to Γ(n+1) = n!. Further results on the beta and gamma functions along with their applications to mechanics – such as the rotation of the earth, and the attraction of ellipsoids – appeared in the second volume. In 1830, he gave a proof of Fermat's Last Theorem for exponent n = 5, which was also proven by Lejeune Dirichlet in 1828. In number theory, he conjectured the quadratic reciprocity law, subsequently proved by Gauss; in connection to this, the Legendre symbol is named after him. He also did pioneering work on the distribution of primes, and on the application of analysis to number theory. His 1798 conjecture of the prime number theorem was rigorously proved by Hadamard and de la Vallée-Poussin in 1896.
== Common biological stains == Different stains react or concentrate in different parts of a cell or tissue, and these properties are used to advantage to reveal specific parts or areas. Some of the most common biological stains are listed below. Unless otherwise marked, all of these dyes may be used with fixed cells and tissues; vital dyes (suitable for use with living organisms) are noted.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
The colour comes from electronic transitions in the coordinated copper(II) ion. Ligand field effects absorb part of the visible spectrum. A colourless or greenish sample may indicate degraded material.
Copper can be displaced by other metal ions, by strong chelating agents, or by low pH. Samples exposed to these conditions may contain a mixture of free peptide and complex. Analytical testing is the only reliable way to confirm the bound fraction.
Solution storage generally shortens shelf life compared with the dry powder. Hydrolysis and oxidation proceed faster in aqueous media. Where solutions are used, cold storage and short holding times reduce measurable change.
GHK-Cu is a complex of the tripeptide glycyl-L-histidyl-L-lysine with copper(II). The peptide coordinates the metal through its histidine imidazole, terminal amino group, and amide nitrogen. It is studied in biochemistry and dermatological research.